PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn064071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family G2-like
Protein Properties Length: 382aa    MW: 42979.4 Da    PI: 6.2543
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn064071genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.1e-31202256155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k+r+rW+++LH+rFve+v++LGG+ekAtPk+il+lm+ +gLt++hvkSHLQkYR 
  Achn064071 202 KARIRWNQDLHDRFVECVNRLGGAEKATPKAILNLMDSEGLTIYHVKSHLQKYRF 256
                 68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.45E-15200256IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.0E-28201257IPR009057Homeodomain-like
TIGRFAMsTIGR015578.1E-23202256IPR006447Myb domain, plants
PfamPF002492.5E-7206255IPR001005SANT/Myb domain
PfamPF143798.5E-19287333IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MGIRNLSPNS EGKSQPNSME NPNSSSSILS RIGSPDSTFY ASERYMGFSQ YENDQDGNPG  60
FPPKQQNDPC FLSADGVYFD APQQADPNFP PKSGPEFGGE THFVSNRNYC SSERSNKSII  120
NYLERDRILL LKRKLFDDFD TSDARQHSIS FDGNQDLEVF HISYSSHSQP EHLRQSASAR  180
PCGGVSVASG NSASSGSALP SKARIRWNQD LHDRFVECVN RLGGAEKATP KAILNLMDSE  240
GLTIYHVKSH LQKYRFAKYM PESAEGRSEK RNSVTDLEQI DLKTGLQLRE ALQMQLDAQR  300
RLHEQLEIQR NLQMRIEEQS RRLKMMFDQQ RKTNVSLFET EISNSTSPDE PSTSTFGDML  360
ISTADGSRNN QFSSENPSMR F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009603787.11e-100PREDICTED: uncharacterized protein LOC104098688
RefseqXP_016456105.11e-100PREDICTED: uncharacterized protein LOC107780100
STRINGPOPTR_0006s20540.17e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.15e-68G2-like family protein